PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang04g17130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 450aa    MW: 50399.6 Da    PI: 7.4028
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang04g17130.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.27.8e-08113155346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       WT+eE ++l d+++++  + +  Ia +++  Rt +++k+r+++
   Vang04g17130.1 113 MWTKEETDQLFDLCERFDLR-FVVIADRFPSSRTVEELKDRYYS 155
                      5*******************.*********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162828.0E-2866160IPR032563DAMP1, SANT/Myb-like domain
SMARTSM007173.1E-8110159IPR001005SANT/Myb domain
SuperFamilySSF466892.53E-6112159IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-6112157IPR009057Homeodomain-like
CDDcd116582.62E-19114156No hitNo description
PfamPF054998.0E-6298360IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MDAKDILGLP KNSFPSLEKK SRPPKESLGS GFLSPALLEK IIFNFTTGSE IVSVRVVNGV  60
PPTGDYSFAK YNKAVDVIKY TDEEYDKFLT NPVVYQVVIV GSPFKLICVN TMMWTKEETD  120
QLFDLCERFD LRFVVIADRF PSSRTVEELK DRYYSVSRAI LVARAPSSGD VAANPLVKEL  180
YNVSQEMERK RALSMVLSQT RQQERRDEEV LVEAKRIAES RIPPKVAEES HLAASNAGAE  240
ATERAVPGET VSPSNVQLPS MVVPPTLSDN ASTLASLRML RVYLRTYALE QMVQAANSSA  300
GLRTIKRVEQ TLQDLGVNLK PRVPTKAVCA EHLELRKEIL TWLNLQKQVQ YKEAEGSSFR  360
DGSYGETPGT PKHLHRAGDQ DRTFIPDAMN FGGGNREKGC FNSKNIFNQN YECGNWLWTQ  420
HLEILIVVQL QFCLLRSAIL DYCHSCSSM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4iej_A3e-1765170493DNA methyltransferase 1-associated protein 1
3hm5_A3e-1765170493DNA methyltransferase 1-associated protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0948860.0BT094886.1 Soybean clone JCVI-FLGm-25A17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014496357.10.0PREDICTED: SWR1-complex protein 4
RefseqXP_014496358.10.0PREDICTED: SWR1-complex protein 4
SwissprotQ8VZL61e-153SWC4_ARATH; SWR1-complex protein 4
TrEMBLA0A0S3S0650.0A0A0S3S065_PHAAN; Uncharacterized protein
TrEMBLA0A0L9U9400.0A0A0L9U940_PHAAN; Uncharacterized protein
STRINGGLYMA19G40630.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49752330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.11e-154MYB_related family protein